PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family BES1
Protein Properties Length: 160aa    MW: 17869.2 Da    PI: 8.7531
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017819genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822117.71.7e-3671149381
       DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaea 81 
                  ++r ++ +E+E++k+RER+RRai+a+i+aGLR++G+y+l++raD+n+V++AL+reAG vv +DGtt++  s+ l+ ++a
  Lus10017819  71 GRRCRPVEEKERTKLRERHRRAITARILAGLRRHGDYNLRVRADINDVIAALAREAGRVVLPDGTTFPSKSQVLRFKKA 149
                  689999**************************************************************88877655444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.7E-3272143IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MATDMQRLIV TSEEEEIDMD VKEEDNRGKH IDAQLMAGID GGMLSDSCDS QFQYHQQLQE  60
QVSTPGGENI GRRCRPVEEK ERTKLRERHR RAITARILAG LRRHGDYNLR VRADINDVIA  120
ALAREAGRVV LPDGTTFPSK SQVLRFKKAL GGRRALGTA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015584438.11e-62PREDICTED: beta-amylase 7 isoform X1
SwissprotO808311e-48BAM7_ARATH; Beta-amylase 7
TrEMBLB9RDR81e-61B9RDR8_RICCO; Beta-amylase
STRINGVIT_15s0046g02640.t015e-52(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1985345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.12e-47beta-amylase 7